SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010694 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010694
Domain Number 1 Region: 102-203
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-28
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 2 Region: 204-309
Classification Level Classification E-value
Superfamily Fibronectin type III 7.79e-18
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000021
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010694   Gene: ENSGGOG00000010973   Transcript: ENSGGOT00000011013
Sequence length 392
Comment pep:known_by_projection chromosome:gorGor3.1:19:18982782:19004338:-1 gene:ENSGGOG00000010973 transcript:ENSGGOT00000011013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRAGSSSHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRV
LNASTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKD
LTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIW
VEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQA
KYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEW
SHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQ
WRAWMQKSHKTRNQDEGILPSGRRGTARGPAR
Download sequence
Identical sequences ENSGGOP00000010694 ENSGGOP00000010694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]