SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010698 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010698
Domain Number 1 Region: 2197-2422
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000908
Family Galacturonase 0.067
Further Details:      
 
Domain Number 2 Region: 1017-1104
Classification Level Classification E-value
Superfamily E set domains 0.0000000103
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 3 Region: 260-313
Classification Level Classification E-value
Superfamily E set domains 0.0000000113
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 
Domain Number 4 Region: 930-1001
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 5 Region: 1571-1645
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family E-set domains of sugar-utilizing enzymes 0.096
Further Details:      
 
Domain Number 6 Region: 1198-1254
Classification Level Classification E-value
Superfamily E set domains 0.00000318
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Domain Number 7 Region: 1388-1473
Classification Level Classification E-value
Superfamily E set domains 0.0000233
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Domain Number 8 Region: 350-402
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0000458
Family Anthrax protective antigen 0.018
Further Details:      
 
Domain Number 9 Region: 1485-1560
Classification Level Classification E-value
Superfamily E set domains 0.0000875
Family Other IPT/TIG domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010698
Domain Number - Region: 1737-1791
Classification Level Classification E-value
Superfamily E set domains 0.00875
Family Other IPT/TIG domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010698   Gene: ENSGGOG00000010943   Transcript: ENSGGOT00000011018
Sequence length 2660
Comment pep:known_by_projection chromosome:gorGor3.1:6:53280017:53522880:-1 gene:ENSGGOG00000010943 transcript:ENSGGOT00000011018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAWLISLMSIEVLLLAVPHLSLHTEPEEGSLAGGTWITVIFDGLELGVLYPNNGSQLEI
HLVNMNMVVPALRSIPCDVFPVFLDLPVVTCRTRSVLSEAHEGLYFLEAYFGGQLVSSPN
PGPRDSCTFKFSKAQTPIVHQVYPPSGVPGKLIHVYGWIITGRLETFDFDAEYIDSPVIL
EAQGDKWVTPCSLINRQMGSRYPIQEDHGLGTLQCRVEGDYIGSQNVSFSVFNKGKSMVH
KKAWLISAKQDLFLYQTHSEILSVFPETGSLGGRTDITITGDFFDNSAQVTIAGIPCDIR
HVSPRKIECTTRAPGKDVRLTTPQPGNRGLLFEVGDAVEGLELTEATPGYRWQIVPNASS
PFGFWSQEGQPFRARLSGFFVAPETNNYTFWIQADSQASLHFSWSEEPRTKVKVASISVG
TADWFDSWEQNRDEGTWQQKTPKLELLGGAMYYLEAEHHGIAPSRGMRIGVQIHNTWLNP
DVVTTYLREKHQIRVRAQRLPEVQVLNVSGRGNFFLTWDNVSSQPIPANATAHLIQTTIE
ELLAVKCELEPLWANILLRLGFERGPEVSNSDGDLTSGTEPFCGRFSLRQPRHLVLTPPA
AQKGYRLDQYTHLCLAYKGHMNKILKMTVSFTIGFQNMVKNTTCDWSLTRTSPESWQFHC
TDIWETCVRCSGDLQPPPANSPVLVHQIDLLPLAQETGLFYVDEIIIADTNVTVSQADSG
TARPGGNLVESVSVVGSPPVYSVTSWLTGCGTELPLITARSVPTEGTEEGSGLVLVMTQR
RQRTSPPLGGHFRIQLPNTVISDVPVQISAHHLHQLLQNNADDFTSRYLNASDFTVKEDL
YTCYEHVWTLSWSTQIGDLPNFIRVSDENLTGVNPAAATRVVYDGGVFLGPIFGDMLATA
NQHTQVVVRVNDVPAHCPGSCSFQYLQGSTPCVHSVWYSVDGDINLMIYITGTGFSGDSQ
FLQVTVNKTSCKVIFSNQTNVVCQTDLLPVGMHRILMMVRPSGLAISATGEDLFLNVEPR
LDMVEPSRAADIGGLWATIRGSSLEGVSLILFGSYSCAINVTTSNSSRIQCKVPPRGKDG
RIVNVTVIRGDYSAVLPRAFTYVSSLNPVIVTLSRNTSNIAGGETLVIGVARLVNCTDLD
VEVHVQDALAPVHTQSAWGLEVALPPLPAGLHRISVSINGVSIRSQGVDLHIQYLTEVFS
IEPCCGSLLGGTILSISGIGFSRDPALVWVLVGNRSCDIVNLTEVSIWCETLPAPQIPHA
GAPTVPAVVEVWAGNRSFARGPSPSLVGKGFTFMYEAAATPVVTAMQGEITNSSLSLHVG
GSNLSNSVILLGNLNCDVETQSFQGNVSLSGCSIPLHSLEAGIYPLQVRQKQMGFANMSV
VLQQFAVMPRIMAIFPSQGSACGGTILTVRGLLLNSRRRSVRVDLSGPFTCVILSLGDHT
ILCQVILEGDPLPGASFSLNVTVLVNGLTSECQGNCTLFIREEASPVMDALSTNTSGSLT
TVLIRGQRLATTADELMVFVDDQLSCNVTFFNASHVVCQTRELAPGPHYLSVFYTRNGYA
CSGNVSRNFYIMPQVFHYFPKNFSIHGGSLLTIEGTGLRGQNTTSVYVDQQACLTVNIGA
ELIRCIVPTGNGSVALEIEVDGLWYHIGVIGYNNAFTPELISISQNDDILTFAVAQISGA
ANIDIFIGMSPCVGVSGNHTVLQCVVPSLPAGEYHVRGYDCIRGWASSALVFTSRVIITA
VTENFGCLGGRLVHVFGAGFSPGNVSAAVCGAPCRVLANATVSAFSCLVLPLDVSLAFLC
GLKREEDSCEAARHTYVQCDLTVAMATEQLLESWPYLYICEESSQCLFVPDHWAESMFPS
FSGLFISPKVERDEVLIYNSSCNITMETEAEMECETPNQPITVKITEIRKRWGQNTQGNF
SLQFCRRWSRTHSWFPERLPQDGDNVTVENGQLLLLDTNTSILNLLHIRGGKLIFMAPGP
IELRAHAILVSDGGELRIGSEDKPFQGRAQITLYGSSYSTPFFPYGVKFLAVRNGTLSLH
GSLPEVIVTRLRATAHALDTVLALEDAVDWHPGDEVVIISGTGVKGAKPMEEIVTVETVQ
DTDLYLKSPLRYSHNFTENWVAGEHHILKATVALLSRSITIQGNLTNEREKLLVSCQEAN
APEGNLQHCLYSMSEKMLGSRDMGARVIVQSFPEEPSQVQLKGVQFQVLGQAFHKHLSSL
TLVGAMRESFIQGCTVRNSFSRGLSMCGTLGLKVDSNVFYNILGHALLVDWSGHGNIIRN
NVIIRVSGAEGLSNPEMLTPSGIYICSPTNVIEGNRVCGAGYGYFFHLMTNQTSQAPLLS
FTQNIAHSCTRYGLFVYPKFQPPWDNVTGTTLFQSFTVWESAGGAQIFRSSNLRLKNFKV
YSCRDFGIDVLESDANTSVTDSLLLGHFAHKGSLCMSSGIKTPKRWELMVSNTTFVNFDL
INCVAIRTCSDCSQGQGGFTVKTSQLKFTNSSNLVAFPFPHAAVLEDLDGSLSGKNRSHI
LASMETLSASCLVNSSFGRVVHGSACGGGVLFHRMSIGLANTPEVSYDLTMTDSRNKTTT
VNYVRDTLSNPHGWMALLLDHETYSLQSENLWINRSLQSTSAPESALKWSLPETWQGVEE
GWGGYNNTIPGPGDDVLILP
Download sequence
Identical sequences ENSGGOP00000010698 ENSGGOP00000010698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]