SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010755 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010755
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.7e-46
Family Peptidyl-tRNA hydrolase-like 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010755   Gene: ENSGGOG00000011033   Transcript: ENSGGOT00000011076
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:9:111243768:111245753:-1 gene:ENSGGOG00000011033 transcript:ENSGGOT00000011076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRYCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCF
SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Download sequence
Identical sequences G3R620
ENSGGOP00000010755 ENSGGOP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]