SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010806 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010806
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.98e-59
Family Ran-binding protein mog1p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010806   Gene: ENSGGOG00000011083   Transcript: ENSGGOT00000011127
Sequence length 186
Comment pep:known_by_projection chromosome:gorGor3.1:17:8507254:8508839:1 gene:ENSGGOG00000011083 transcript:ENSGGOT00000011127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTTDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQIAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences G3R667
XP_004058600.1.27298 ENSGGOP00000010806 ENSGGOP00000010806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]