SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010838 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010838
Domain Number 1 Region: 589-791
Classification Level Classification E-value
Superfamily Fibronectin type III 6.79e-40
Family Fibronectin type III 0.00000387
Further Details:      
 
Domain Number 2 Region: 1201-1395
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-38
Family Fibronectin type III 0.000000857
Further Details:      
 
Domain Number 3 Region: 992-1199
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-36
Family Fibronectin type III 0.0000033
Further Details:      
 
Domain Number 4 Region: 791-982
Classification Level Classification E-value
Superfamily Fibronectin type III 6.66e-34
Family Fibronectin type III 0.0000022
Further Details:      
 
Domain Number 5 Region: 1723-1919
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-33
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 1557-1724
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-30
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 7 Region: 1398-1543
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-30
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 8 Region: 25-91,135-203
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-21
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 
Domain Number 9 Region: 401-492
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 300-398
Classification Level Classification E-value
Superfamily Immunoglobulin 7.08e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 497-596
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 12 Region: 214-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000172
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010838   Gene: ENSGGOG00000011094   Transcript: ENSGGOT00000011159
Sequence length 2216
Comment pep:known_by_projection chromosome:gorGor3.1:5:9690731:10019838:1 gene:ENSGGOG00000011094 transcript:ENSGGOT00000011159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLLIWTLLALHQIRAARAQDDVSPYFKTEPVRTQVHLEGNRLVLTCMAEGSWPLEFKW
LHNNRELTKFSLEYRYMITSLDRTHAGFYRCIVRNRMGALLQRQTEVQVAYMGSFEEGEK
HQSVSHGEAAVIRAPRIASFPQPQVTWFRDGRKIPPSSRIAITLENTLVILSTVAPDAGR
YYVQAVNDKNGDNKTSQPITLTVENVGGPADPIAPTIIIPPKNTSVVAGTSEVTLECVAN
ARPLIKLHIIWKKDGVLLSGGISDHNRRLTIPNPTGSDAGYYECEAVLRSSSVPSVVRGA
YLSVLEPPQFVKEPERHITAEMEKVVDIPCRAKGVPPPSITWYKDAAVVEVEKLTRFRQR
SDGGLQVSGLVPDDTGMFQCFARNAAGEVQTSTYLAVTSIAPNITRGPLDSTVIDGMSVV
LACETSGAPRPAITWQKGERILASGSVQLPRFTPLESGSLLISPTHISDAGTYTCLATNS
RGVDEASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTHDPRVTIRYIWEKDGATLGT
ESHPRIRLDRNGSLHISQTWSGDIGTYTCRVISAGGNDSRSAHLRVRQLPHAPEHPVATL
STVERRAINLTWTKPFDGNSPLIRYILEMSENNAPWTVLLASVDPKATSVTVKGLVPARS
YQFRLCAVNDVGKGQFSKDTERVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESHQN
GILKGYIIRYCLAGLPVGYQFKNITDADVNNLLLEDLIIWTNYEIEVAAYNSAGLGVYSS
KVTEWTLQGVPTVPPGNVHAEATNSTTIRFTWNAPSPQFINGINQGYKLIAWEPEQEEEV
TMVTARPNFQDSIHVGFVSGLKKFTEYFTSVLCFTTPGDGPRSTPQLVRTHEDVPGPVGH
LSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTA
LTTYTIEVAAMTSKGQGQVSASTISSGVPPELPGPPTNLGISNIGPRSVTLQFRPGYDGK
TSISRWLVEAQVGVVGEGEEWLLIHQLSNEPDARSMEVPDLNPFTYYSFRMRQVNIVGTS
PPSQPSRKIQTLQAPPDMAPANVSLRTASETSLWLRWMPLPEMEYNGNPESVGYKIKYSR
SDGHGKMLSHVVQDRVEREYTIEDLEEWTEYRVQVQAFNAIGSGPWSQTVVGRTRESVPS
SGPTNVSALATTSSSMLVRWSEVPEADRNGLVLGYKVMYKEKDSDTQPRFWLVEGNSSRS
AQLTGLGKYVLYEVQVLAFTRIGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLI
WQPPATPNGIILAYQITHRLNTTTANTATVEVLAPSARQYTATSLKPESVYLFRITAQTR
KGWGEAAEALVVTTEKRDRPQPPSRPMVQQEDVRARSVLLSWEPGSDGLSPVRYYTIQTR
ELPGGRWALHSASVSHNASSFVVDRLKPFTSYKFRVKATNDIGDSEFSEESESLTTLQAA
PDEAPTILSVTPHTTTSVLIRWQPPAEDKINGILLGFRIRYRELLYEGLRGFTLRGINNP
GATWAELTSMYSMRNLSRPSLTQYELDNLNKHRRYEIRMSVYNAVGEGPSSPPQEVFVGE
AVPTAAPRNVVVHGATATQLDVTWEPPPLDSQNGDIQGYKIYFWEAQRGNLTERVKTLFL
AENSVKLKNLTGYTAYVVSVAAFNAAGDGPRSTPTQGQTQQAAPSAPSSVKFSELTTTSV
NVSWEAPQFPNGILEGYRLVYEPCSPVDGVSKIVTVDVKGNSPLWLKVKDLAEGVTYRFR
IRAKTFTYGPEIEANVTTGPGEGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPITRYVIE
ARPSDEGLWDILIKDIPKEVSSYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSPSQSVPA
QKANPFYEEWWFLVVIALVGLIFILLLVFVLIIRGQSKKYAKKTDSGNSAKSGALGHSEM
MSLDESSFPALELNNRRLSVKNSFCRKNGLYTRSPPRPSPGSLHYSDEDVTKYNDLIPAE
SSSLTEKPSEISDSQGSDSEYEVDSNHQKAHSFVNHYISDPTYYNSWRRQQKGISRAQAY
SYTESDSGEPDHAAVTNSTSTQQGSLFRPKASRTPTPQNPPNPPSQQSTLYRPPSKAGVQ
KEGENRERMCVASSSSALRWWGSLLPWELHGAGEVAVSLLWTRSGAGIWRQRGSGG
Download sequence
Identical sequences ENSGGOP00000010838 ENSGGOP00000010838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]