SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010871 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010871
Domain Number 1 Region: 788-1035
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.66e-78
Family Eukaryotic proteases 0.0000652
Further Details:      
 
Domain Number 2 Region: 454-575
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.12e-35
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 138-250
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.81e-31
Family Frizzled cysteine-rich domain 0.00062
Further Details:      
 
Domain Number 4 Region: 384-425
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 579-617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 655-699
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 343-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 270-307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 307-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 621-653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 712-791
Classification Level Classification E-value
Superfamily SRCR-like 0.0000275
Family Hepsin, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010871   Gene: ENSGGOG00000011143   Transcript: ENSGGOT00000011192
Sequence length 1043
Comment pep:known_by_projection chromosome:gorGor3.1:4:48030798:48284541:-1 gene:ENSGGOG00000011143 transcript:ENSGGOT00000011192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSPALAPEERYRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVL
LLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDDVILTNTIYNQSTVVSTAHPDQHVP
AWTTDASLPGDQSHRNTSACMNITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLH
RLSCYQHIMLFGCSLAFPECVIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLR
CSQFRNQTESSNVSRICFSPQQENGKQLLCGTGENFLCASGICIPRKLQCNGYNDCDDWS
DEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAME
WVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQT
SCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGH
RTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGQRIPPCRALCEHSKER
CESVLGIVGLQWPEDTDCSQFPEENSDNRTCLMPDEYVEECSPSHFKCRSGRCVLASRRC
DGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDE
LECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQ
EMLSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHEFLVNGQSCESRS
KISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVL
TVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELS
EDINETGYVRPVCLPNPEQWLQPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYF
DVKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGV
YSNVSYFVEWIKRQIYIQTFLLN
Download sequence
Identical sequences ENSGGOP00000010871 ENSGGOP00000010871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]