SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010881 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010881
Domain Number 1 Region: 434-472
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000301
Family Hormone receptor domain 0.0081
Further Details:      
 
Domain Number 2 Region: 770-1038
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000033
Family Rhodopsin-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010881
Domain Number - Region: 231-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00025
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010881   Gene: ENSGGOG00000011154   Transcript: ENSGGOT00000011203
Sequence length 1077
Comment pep:known_by_projection chromosome:gorGor3.1:2a:26746548:26755628:-1 gene:ENSGGOG00000011154 transcript:ENSGGOT00000011203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSAAPLLLLATTLPLLGSPVAQASQPVSETGVRPREGLQRQQWRPLIGRDKAWNERID
RPFPACPIPSSSFGRWPKGQTMWAQTSTLTLTEELGQSQAGGESGSGQLLDQENGAGESA
LVSVYAHLDFPDKTWPPELSRTLTLPAASASSSPRPLLTGLRLTTECNVNHEGNFYCACL
SGYQWNTSICLHYPPCQSLHNHQPCGCLVFSHPEPGYCQLLPPGSPVAYLPAVPGILNLN
SQLQMPGDTLSLTLHLSQEATNLSWFLRHPGSPSPILLQPGTQVAVTSSHGQAVLSISNM
SHHWAGEYMSRFEAQGFTWNLYEVVRVPLKATDVARLPYQLSISCATFPGFQLSCCIPST
NLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYTCDLQSPGLASLRVPISIT
IIQDGDITCPEDASVLTWNVTKAGHVAEAPCPESKRGIVRRLCGADGVWGPVHSSCTDAR
LLALFTRTKLLQAGQGSPAEEVPQILAQLPGQAAEASSPSDLLTLLSTMKYVAKVVTEAR
IQLDRRALKNLLIATDKVLDMDTRSLWTLAQARKPWAGSTLLLAVETLACSLCPQDRPFA
FSLPNVLLQSQLFGPTFPADYSISFPTRPPLQAQIPGHSLAPLVRNGTEISITSLVLRKL
DHLLPSNYGQGLGDSLYATPGLVLVISIMAGDQAFSQGEVIMDFGNTDGSPHCVFWDHSL
FQGRGGWSKEGCQAQVASASPTAQCLCQHLTAFSILMSPHTVPEEPALALLTQVGLGASI
LALLVCLGVYWLVWRVVVRNKISYFRHATLLNMVFCLLAADTCFLGAAFLSPGPRSPLCL
AAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLPKHRVLPLMVLLGYLCPLGLAGVTL
GLYLPQGQYLREGECWLDGKGGALYTFVGPVLAIVGVNGLVLAMAMLKLLRPSLSEGPPA
EKRQALLGVTKALLILTPIFGLTWGLGLATLLEEVSTVPHYIFTILNTLQGVFILLFGCL
MDRKIQEALRKRFCHAQAPNSTISLVSCCLQILSCASESMSEGIPWPSSEDMGTARS
Download sequence
Identical sequences ENSGGOP00000010881 ENSGGOP00000010881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]