SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010896 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010896
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.11e-63
Family Alanine racemase-like, N-terminal domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.16e-34
Family Eukaryotic ODC-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010896   Gene: ENSGGOG00000011173   Transcript: ENSGGOT00000011219
Sequence length 448
Comment pep:known_by_projection chromosome:gorGor3.1:8:102067471:102105659:-1 gene:ENSGGOG00000011173 transcript:ENSGGOT00000011219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQI
KYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDSMMKNFFFVPSCIQLSQEDSFSAEA
Download sequence
Identical sequences A0A024R9C7 G3R6E6 H2QWJ3 O14977
ENSP00000321507 ENSP00000337180 ENSGGOP00000010896 gi|21361583|ref|NP_056962.2| gi|22538418|ref|NP_680479.1| ENSPTRP00000035031 ENSP00000321507 ENSPTRP00000035031 NP_001267332.2.37143 NP_001278422.1.60992 NP_001278440.1.27298 NP_001288648.1.37143 NP_001288659.1.60992 NP_001288664.1.27298 NP_056962.2.87134 NP_056962.2.92137 NP_680479.1.87134 NP_680479.1.92137 XP_008973390.1.60992 XP_011515428.1.92137 XP_011515429.1.92137 XP_016814398.1.37143 XP_018887391.1.27298 9598.ENSPTRP00000035031 9606.ENSP00000321507 ENSGGOP00000010896 ENSP00000321507 ENSP00000337180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]