SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010930 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010930
Domain Number 1 Region: 334-430
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 451-780
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 4.18e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 65-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000043
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000031
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 179-250
Classification Level Classification E-value
Superfamily EF-hand 0.00000085
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010930   Gene: ENSGGOG00000011205   Transcript: ENSGGOT00000011254
Sequence length 842
Comment pep:known_by_projection chromosome:gorGor3.1:5:116591033:117004761:-1 gene:ENSGGOG00000011205 transcript:ENSGGOT00000011254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNE
LLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACL
LGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDRRQDPASQKRLLVE
SLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYM
AFQVVELSLAPEDRVSVTTVTVGLSTVLTCAVRGDLRPPIIWKRNGLTLNFLDLEDINDF
GEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASL
RCHAEGIPMPRITWLKNGMDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVG
VDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTE
KIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGV
DPLPAKLSYDKSHDQVWVLSWGDVHKSQPSLQVITEASAGQSQHLIRTPFAGVDDFFIPP
TNLIINHIRFGFIFNKSDPAVHKVDLETMMPLKTIGLHHHGCVPQAMAHTHLGGYFFIQC
RQDSPTSAARQLLVDSVTDSVLGPNGDVTGTPHTSPDGRFIVSAAADSPWLHVQEITVQG
EIQTLYDLQINSGISDLAFQHSFTESNQYNIYAALHTEPDLLFLELSTGKVGMLKNLKEP
PTGPAQPWGGAHRIMRDSGLFGQYLLTPARESLFLINGRQNTLRCEVSGIKGGTTVVWVG
EV
Download sequence
Identical sequences ENSGGOP00000010930 ENSGGOP00000010930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]