SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010955 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010955
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily L domain-like 4e-40
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 231-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000213
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010955   Gene: ENSGGOG00000011238   Transcript: ENSGGOT00000011279
Sequence length 428
Comment pep:novel chromosome:gorGor3.1:15:53786038:53789160:1 gene:ENSGGOG00000011238 transcript:ENSGGOT00000011279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSAN
RLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHN
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINDN
PFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASS
QPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFH
GKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQRPPGLLLLGQSLL
LLFFLTSF
Download sequence
Identical sequences G3SK56
XP_004056532.1.27298 XP_004056536.1.27298 XP_018866401.1.27298 XP_018866402.1.27298 ENSGGOP00000010955 ENSGGOP00000028499 ENSGGOP00000010955 ENSGGOP00000028499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]