SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010963 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010963
Domain Number 1 Region: 124-216
Classification Level Classification E-value
Superfamily Immunoglobulin 3.55e-16
Family I set domains 0.048
Further Details:      
 
Domain Number 2 Region: 213-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000286
Family I set domains 0.04
Further Details:      
 
Domain Number 3 Region: 35-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000001
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010963   Gene: ENSGGOG00000011245   Transcript: ENSGGOT00000011287
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:19:48649515:48667023:1 gene:ENSGGOG00000011245 transcript:ENSGGOT00000011287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHV
TRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQP
YTTQVYLIVHVPARIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEIL
EISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEA
MAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAPGSLENS
APRPPGLLALLSALGWLWWRM
Download sequence
Identical sequences ENSGGOP00000010963 ENSGGOP00000010963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]