SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011052 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011052
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily POZ domain 4.32e-30
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 398-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000022
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 377-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011052   Gene: ENSGGOG00000011339   Transcript: ENSGGOT00000011379
Sequence length 504
Comment pep:known_by_projection chromosome:gorGor3.1:9:110343041:110349526:1 gene:ENSGGOG00000011339 transcript:ENSGGOT00000011379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPY
FRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQCVID
KCTQILESIHSKISVGDVDSVTVGAEENPESRNGVKDSSFFANPVEISPPYCSQGRQPTA
SSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSEYEIQIEGDHEQGDLLVRESQITEVKV
KMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAASQPTNVS
EAFGSLSNSSPSRSMLSCFRGGRARQKRALSVHLHSDLQGLVQGSDSEAMMNNPGYESSP
RERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLE
YHIRGHTDDKPFRCEICGKCFPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYVEQKLE
NDASASEMGLDSRMEIHTVSDAPD
Download sequence
Identical sequences A0A096P214 A0A0C4DFQ2 A0A2I2ZRF2 A0A2K5HFK2 A0A2K5KZ00 A0A2K5XQF1 A0A2K6B2K2 A0A2K6NH77 F7ITA7 G1SBG4 G7NEQ0 G8F587 H2PTF2 H2QXW8
ENSCJAP00000040548 XP_001097093.1.72884 XP_001142000.2.37143 XP_003264201.1.23891 XP_004048667.1.27298 XP_008004398.1.81039 XP_008004399.1.81039 XP_008004400.1.81039 XP_008975981.1.60992 XP_009243141.1.23681 XP_009243142.1.23681 XP_010364186.1.97406 XP_011517001.1.92137 XP_011709684.1.29376 XP_011786759.1.43180 XP_011843946.1.47321 XP_011894503.1.92194 XP_011894504.1.92194 XP_011894505.1.92194 XP_014972299.1.72884 XP_017730225.1.44346 XP_017730226.1.44346 ENSP00000317534 ENSPTRP00000036536 ENSP00000317534 9598.ENSPTRP00000036536 9600.ENSPPYP00000021982 ENSPPYP00000021982 ENSPTRP00000036536 ENSGGOP00000011052 ENSPPYP00000021982 ENSGGOP00000011052 ENSP00000317534 ENSCJAP00000040548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]