SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011082 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011082
Domain Number 1 Region: 292-388
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000436
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 122-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000458
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000955
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011082   Gene: ENSGGOG00000011367   Transcript: ENSGGOT00000011409
Sequence length 823
Comment pep:known_by_projection chromosome:gorGor3.1:7:17419095:17465106:1 gene:ENSGGOG00000011367 transcript:ENSGGOT00000011409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQLPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPISC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIATQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYDATNPF
PAIMDPLPVRTKNGTSGKDSATTSTLNKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGDDTILKHEQIDQPQDGNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIKHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMLCQKMKHMQVNGMFENWNSNQFMPFNCPRQDPQQYNVFTDLHGISQEF
PYKSEMDSMPYTQNFISCNQPVLPQHSECTELDYPMGSFEPSPYPTASSLEDFVTCLQLP
ENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNG
VLNETYPAELNNINNTQTTTHLQPLHHPSEARPFPDLTSSGFL
Download sequence
Identical sequences ENSGGOP00000011082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]