SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011109 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011109
Domain Number 1 Region: 61-234
Classification Level Classification E-value
Superfamily L domain-like 1.02e-26
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 229-328
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 358-434
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000448
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011109   Gene: ENSGGOG00000011395   Transcript: ENSGGOT00000011436
Sequence length 703
Comment pep:known_by_projection chromosome:gorGor3.1:19:36704710:36712441:-1 gene:ENSGGOG00000011395 transcript:ENSGGOT00000011436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPFSSALLSPPPAALPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVV
RGDQLRGLGNLRHLILGNNQIRRVESAAFDAFLSTVEDLDLSYNNLEALPWEAVGQMVNL
NTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGTGPKPPTPLTVS
FGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPLITRQAGGR
ALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVTITTLRDSGTF
TCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSSDIATPGRPGANDSAAERRL
VAAELTSNSVLIRWPAQRPVPGIRMYQVQYNSSVDDSLVYRMIPSTSQTFLVNDLAAGRA
YDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAIGGVIVASV
LVFIVLLMIRYKVYGDGDSRRVKGSRSLPRVSHVCSQTNGAGTGAAQAPALPAQDRYEAL
REVESQAAPAVAVEAKAMEAETASAEPEVVLGRSLGGSATSLCLLPSEETSGEESWAAVG
PRRSRSGALEPPTSAPPTLALVPGGAAARPRPQQRYSFDGDYGALFQSHSYPRRARRTKR
HRSTPHLDGAGGGAAGEDGDLGLGSARARLAFTSTEWMLESTV
Download sequence
Identical sequences ENSGGOP00000011109 ENSGGOP00000011109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]