SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011206 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011206
Domain Number 1 Region: 41-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000698
Family I set domains 0.0071
Further Details:      
 
Domain Number 2 Region: 237-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000326
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 3 Region: 139-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000641
Family I set domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011206   Gene: ENSGGOG00000011488   Transcript: ENSGGOT00000011535
Sequence length 398
Comment pep:known_by_projection chromosome:gorGor3.1:2a:99473153:99530234:1 gene:ENSGGOG00000011488 transcript:ENSGGOT00000011535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMRAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDASLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
Download sequence
Identical sequences G3R776
ENSGGOP00000011206 XP_004031569.1.27298 XP_004031570.1.27298 XP_018876152.1.27298 ENSGGOP00000011206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]