SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011269 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011269
Domain Number 1 Region: 29-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000297
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011269   Gene: ENSGGOG00000011554   Transcript: ENSGGOT00000011599
Sequence length 161
Comment pep:known_by_projection chromosome:gorGor3.1:11:117366191:117372155:-1 gene:ENSGGOG00000011554 transcript:ENSGGOT00000011599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Download sequence
Identical sequences B0YJA4 G3R7D4 H2Q4Y7 P04216
ENSP00000284240 ENSP00000431301 NP_001298089.1.87134 NP_001298089.1.92137 NP_001298091.1.87134 NP_001298091.1.92137 NP_006279.2.87134 NP_006279.2.92137 XP_003313415.1.37143 XP_003820039.1.60992 XP_004052326.1.27298 ENSPTRP00000007508 ENSPTRP00000007508 ENSGGOP00000011269 ENSP00000284240 ENSP00000431301 9598.ENSPTRP00000007508 9606.ENSP00000284240 ENSGGOP00000011269 gi|19923362|ref|NP_006279.2| 846 GO.46765 NYSGRC-IgSF-THY1_HUMAN OPTIC8933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]