SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011283 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011283
Domain Number 1 Region: 932-1060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.06e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 670-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 591-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000533
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 890-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000147
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 764-903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000001
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 1051-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011283
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00272
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011283   Gene: ENSGGOG00000011561   Transcript: ENSGGOT00000011613
Sequence length 1218
Comment pep:known_by_projection chromosome:gorGor3.1:3:13957517:14024937:1 gene:ENSGGOG00000011561 transcript:ENSGGOT00000011613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLWEPAGAWLALGLALAVGPSVASAAPRQDCTGVECPPLENCIEEALEPGACCATCVQ
QGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCVHAGRKYAAGHTVHLPPCRACHCPDAGGELICYQLPGCHGN
FSDAEEGDPERHYEDPYSYDQEVAEVEAAAALGGEVQAGAVQAGAGGPPAALGGGSQPLS
TIQAPPWPAALPRPTAAAALGPPAPVQAKARRVTEDKMAVTEQLEAGGHRGLDGLPTTAP
AGPSLPIQEEKAEAGARAEAGARPEENLIPDAQATSRSTGLEGVTPAPGLGKAALVPTQA
VPGSPRDPVKPSPHTILSTSLPDAAWIPPTQEVPRKPQVLPHSHVEEDTDPNSVHSIPRS
SPEATVKGHIWTCSEAGTAWPRDARTCSELTPDEGCRSVQLQACSSWPRESLQSPAAMVG
IKEGENAGGQRSELCGLGLWYFKQCCDCCGLGLRVRAEGQLCESNPNLGYPCNHVMLSCC
EGEEPLIVPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSLPGDDQDECLLLPG
ELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKSEFSQVASNTI
PLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDQDECLMGAHDCSRR
QFCVNTLGSFYCVNHTVLCADGYILNAHRKCVDINECVTDLHTCSRGEHCVNTLGSFHCY
KALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEG
NCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGAKCVDVNECETGV
HRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDVNECWASPGRLCQHTCENTLGSYRC
SCASGFLLAADGKRCEDVNECEAQRCSQECANIYGSYQCYCRQGYQLAEDGHTCTDIDEC
AQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQ
GSFRCLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARITHYQLNFQTGLLVPAHIFRI
GPAPAFTGDTIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQG
SVTTFLAKMHIFFTTFAL
Download sequence
Identical sequences ENSGGOP00000011283 ENSGGOP00000011283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]