SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011288 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011288
Domain Number 1 Region: 411-713
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.42e-73
Family Protein kinases, catalytic subunit 0.000000447
Further Details:      
 
Domain Number 2 Region: 248-370
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-35
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 36-124
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011288
Domain Number - Region: 142-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0366
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011288   Gene: ENSGGOG00000011571   Transcript: ENSGGOT00000011618
Sequence length 911
Comment pep:known_by_projection chromosome:gorGor3.1:9:73582980:73636069:-1 gene:ENSGGOG00000011571 transcript:ENSGGOT00000011618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPN
VRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFV
RLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTM
IGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRQEYTIAR
SNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTK
SGHQCQPWALQHPHSHHLSSTDFPELAGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVP
SCSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQRRQLMASPSQDM
EMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDK
AEGPLREEFRHEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHS
DVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKIS
DLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQP
YCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNL
SNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMV
PPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTG
YVTTAPSNTSVADRAALLSEGADDTQNAPEDGAQSPVQEAEEEEEGSVPETELLGDCDTL
QVDEAQVQLEA
Download sequence
Identical sequences ENSGGOP00000011288 ENSGGOP00000011288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]