SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011341 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011341
Domain Number 1 Region: 854-936
Classification Level Classification E-value
Superfamily DEATH domain 4.62e-22
Family DEATH domain, DD 0.00000813
Further Details:      
 
Domain Number 2 Region: 154-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 244-295
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 297-352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 47-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000319
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011341   Gene: ENSGGOG00000011623   Transcript: ENSGGOT00000011671
Sequence length 944
Comment pep:known_by_projection chromosome:gorGor3.1:10:83819486:83840924:1 gene:ENSGGOG00000011623 transcript:ENSGGOT00000011671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPAGLWLPHLCLPCPLRLRWAPGVGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVK
NKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELF
GLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVP
VAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATV
IVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPV
DGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLS
DPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGGF
HPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPSLK
VKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFAQDTHFLHLRSASLGSQQLLGLPRDP
GSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVL
SPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTPC
YCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDTP
VALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYH
IWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLCS
APGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKAS
PTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC
Download sequence
Identical sequences ENSGGOP00000011341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]