SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011384 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011384
Domain Number 1 Region: 2-355,385-398
Classification Level Classification E-value
Superfamily Thiolase-like 9.82e-76
Family Thiolase-related 0.0022
Further Details:      
 
Domain Number 2 Region: 2146-2422
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.36e-65
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000118
Further Details:      
 
Domain Number 3 Region: 1560-1724
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.72e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000957
Further Details:      
 
Domain Number 4 Region: 418-538,601-698
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-38
Family FabD-like 0.0057
Further Details:      
 
Domain Number 5 Region: 1804-1993
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.3e-34
Family Tyrosine-dependent oxidoreductases 0.00028
Further Details:      
 
Domain Number 6 Region: 1145-1325
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.99e-17
Family UbiE/COQ5-like 0.032
Further Details:      
 
Domain Number 7 Region: 1480-1595
Classification Level Classification E-value
Superfamily GroES-like 8.38e-17
Family Alcohol dehydrogenase-like, N-terminal domain 0.0057
Further Details:      
 
Domain Number 8 Region: 2045-2109
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000051
Family Acyl-carrier protein (ACP) 0.00022
Further Details:      
 
Domain Number 9 Region: 538-594
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000222
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011384   Gene: ENSGGOG00000011647   Transcript: ENSGGOT00000011716
Sequence length 2432
Comment pep:known_by_projection chromosome:gorGor3.1:5:1071568:1226796:1 gene:ENSGGOG00000011647 transcript:ENSGGOT00000011716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYVEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGIWAPNLHFH
SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSLDGHTVARDGAEPRDMLSGTGM
GTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVHAFVSLTAI
QIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYWRGQCIKEAHLPPGA
MAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGG
MAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNL
VSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCTIIPLMKKDHKDNLEFFLAG
IGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSLAWDVPAAEDFPNGSGSPSA
AVYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLARALGLGVEQLPVVFEDVVL
HQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQWDDPDPRLFHHPESPTPNP
AEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRLLWKDNWVSFVDTMLQMSIL
GSAKHGLYLPTRITAIHIDPATHRQKLYTLQDKAQVADVVVSRWLRVTVAGGVHISGLHT
ESAPRRQQEQQVPILEKFCFTPHMEEGCLSERAALQEELQLCKGLAQALQTKVTQQGLKM
VVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLL
DSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQA
LEAAQAELQQHNVAQGQWDPTDPVPNALGSADLLVCNCAVAALGDPASALSNMVAALREG
GFLLLHTLLRGHPLGDIVAFLTSAEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGST
LFLCRRPAPQDSPIFLPVDDTSFRWVESLKGILADEDSSRPVWLKAINCATSGVVGLVNC
LRREPGGNRLRCVLLSNLSSTSRVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLL
EEDKPEEPTAHAFVTTLTRGDLSSIRWVCSSLRHAQPTCPGAQLCTVYYASLNFRDIMLA
TGKLSPDAIPGKWTSQDSLLGMEFSGRDTSGKRVMGLVPAKGLATSVLLSPDFLWDVPSN
WTLEEAASVPVVYSTAYYALVVRGRVRPGETVLIHSGSGGVGQAAIAIALSLGCRVFTTV
GSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRC
LATHGRFLEIGKFDLSQNHPLGMAIFLKSVTFHGVLLDAFFNESSADWREVWALVQAGIR
DGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPEAVLKGAKPKLMSAISKT
FCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQV
QVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDAMLENQTPEFFQDVCKPKYSGT
LNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRHEGLPGLAVQ
WGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAYR
DRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSMREV
RQLTLGKLQQLSSKADEANELASPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQS
SERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPE
GPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGC
EAEAETEAICFFVQQFTDMEHNKVLEVLLPLKGLEERVAAAVDLIIKSHQGLDRQELSFA
ARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSIHVIEG
DHRTLLEGSGLESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSGGOP00000011384 ENSGGOP00000011384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]