SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011420 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011420
Domain Number 1 Region: 159-187,214-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.86e-60
Family Voltage-gated potassium channels 0.00047
Further Details:      
 
Domain Number 2 Region: 33-130
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011420   Gene: ENSGGOG00000011711   Transcript: ENSGGOT00000011753
Sequence length 499
Comment pep:known_by_projection chromosome:gorGor3.1:1:113543815:113546916:-1 gene:ENSGGOG00000011711 transcript:ENSGGOT00000011753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV
Download sequence
Identical sequences A0A2J8JXE4 A0A2J8UM95 F1MKB0 P16389 S9W5C4 W5PQ46
ENSOARP00000012573 ENSP00000358785 ENSBTAP00000020543 gi|4826782|ref|NP_004965.1| ENSP00000314520 ENSP00000415257 ENSP00000433109 9598.ENSPTRP00000051851 9606.ENSP00000314520 9913.ENSBTAP00000020543 ENSP00000314520 ENSP00000433109 ENSNLEP00000004391 ENSNLEP00000004391 ENSGGOP00000011420 ENSPTRP00000051851 ENSGGOP00000011420 NP_004965.1.87134 NP_004965.1.92137 XP_001162925.1.37143 XP_002810508.1.23681 XP_003267995.1.23891 XP_003810710.1.60992 XP_004002358.1.66739 XP_004026361.1.27298 XP_005204216.1.76553 XP_005204217.1.76553 XP_005204218.1.76553 XP_005204220.1.76553 XP_005677978.1.57651 XP_005985336.1.78601 XP_006194817.1.101512 XP_006197502.1.17985 XP_008961240.1.60992 XP_008961241.1.60992 XP_008961242.1.60992 XP_008961243.1.60992 XP_009244811.1.23681 XP_010829165.1.44457 XP_010829166.1.44457 XP_010829167.1.44457 XP_010829170.1.44457 XP_010829171.1.44457 XP_010829172.1.44457 XP_011539698.1.92137 XP_011539699.1.92137 XP_011539700.1.92137 XP_011539701.1.92137 XP_011539702.1.92137 XP_011979517.1.54773 XP_011979518.1.54773 XP_011979521.1.54773 XP_011979522.1.54773 XP_011979523.1.54773 XP_012033656.1.66739 XP_012033662.1.66739 XP_012033667.1.66739 XP_012355854.1.23891 XP_014423290.1.101512 XP_015099833.1.17985 XP_015099839.1.17985 XP_016781310.1.37143 XP_016781315.1.37143 XP_016781318.1.37143 XP_016856702.1.92137 XP_017901386.1.57651 XP_018871133.1.27298 XP_018871197.1.27298 XP_018871263.1.27298 XP_019812432.1.53367 XP_020735826.1.74333 XP_020735827.1.74333 ENSPTRP00000051851 ENSBTAP00000020543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]