SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011440 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011440
Domain Number 1 Region: 281-381,413-437,477-580,629-734
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.06e-49
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 86-207,265-431
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.21e-42
Family WD40-repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011440   Gene: ENSGGOG00000011712   Transcript: ENSGGOT00000011773
Sequence length 1513
Comment pep:known_by_projection chromosome:gorGor3.1:15:20285725:20349512:1 gene:ENSGGOG00000011712 transcript:ENSGGOT00000011773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPS
GLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDV
AEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVT
AVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVACGR
GKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTTTVAHCISVSQDYIFCGCADGT
VRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANGRYPDTIALTFDPTNEWLSC
VYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDN
TIRLWNTESSGVHGSTLHRNILSSDLIKIIYVDGNTQALLDTELPGGDKADASLLDPRVG
IRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSQILCLEYSKPDTGLKLLAS
ASRDRLIHVLDAGREYSLQQMLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQKS
GDGVQFTWTHHVVRKTTLYDMDVEPSWKYMAISCQDRNIRIFNISSGKQKKLFKGSQGED
GTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISV
SGDSCIFVWRLSSEMTISMRQRLAELRQRQRGGKQQGPSSPQKASGPNRHQAPSMLSPGP
ALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQESVGFL
DPAPAANPGPRRRGRWVQPGVELSVRSMLDLRQLETLAPSLQDPSQDSLAIIPSGPRKHG
QQALETSLTSQNEKPPRPQASQPCSYPHIIRLLSQEEGVFAQDLEPAPIEDGIVYPEPSD
SPTMDTSEFQVQAPARGTLGRVYPGSRSSEKHSPDSACSVAYSSSCLSSPEHPTEDSEST
EPLSVNGISSDLEEPAEGDEEEEEEEGDVGPYGLQEGSPQTPDQEQFLKQHFETLASGAA
PGAPVQVPERSESRSISSRFLLQVQTRPLREPSPSSSSLALMSRPAQVPQASGEQPRGNG
ANPPGAPPEVEPSSGNPSPQQAASVLLPRCHLSPDSSWAPKRVATASPFSGLQKAQSVHS
LVPQERDEASLQAPSPGALLSQEMEAQDGLGSLPPADGRPSRPHSYQNSTTSSMAKISRS
ISVGENLGLVAEPQAHAPIRVSPLSKLALPSRAHLVLDIPKPLPDRPTLAAFSPVTKGRA
PGEAEKPGFPVGLGKAHSTTERWACLGEGPTPKPRTECQAHPGPSSPCAQQLPVSSLFQG
PENLQPPPPEKTPNPMECTKPGAALSQDSEPAVSLEQCEQLVAELRGSVRQAMRLYHSVA
GCKMPSAEQSRIAQLLRDTFSSVRQELEAVAGAVLSSPGSSPGAVGAKQTQALLEQYSEL
LLRAVERRMERKL
Download sequence
Identical sequences ENSGGOP00000011440 ENSGGOP00000011440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]