SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011451 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011451
Domain Number 1 Region: 57-169
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.26e-38
Family Frizzled cysteine-rich domain 0.0000959
Further Details:      
 
Domain Number 2 Region: 184-308
Classification Level Classification E-value
Superfamily TIMP-like 1.35e-20
Family Netrin-like domain (NTR/C345C module) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011451   Gene: ENSGGOG00000011745   Transcript: ENSGGOT00000011784
Sequence length 314
Comment pep:known_by_projection chromosome:gorGor3.1:8:41371116:41418268:-1 gene:ENSGGOG00000011745 transcript:ENSGGOT00000011784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRSVGGRRGAVLGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
Download sequence
Identical sequences A0A2I2ZPQ6
ENSGGOP00000011451 ENSGGOP00000011451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]