SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011482 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011482
Domain Number 1 Region: 27-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.43e-55
Family MHC antigen-recognition domain 0.00000000832
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-21
Family C1 set domains (antibody constant domain-like) 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011482   Gene: ENSGGOG00000011777   Transcript: ENSGGOT00000011815
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:1:137182589:137186568:1 gene:ENSGGOG00000011777 transcript:ENSGGOT00000011815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGQDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELEKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQDTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Download sequence
Identical sequences G3R7Y4
XP_004027070.1.27298 XP_018880543.1.27298 ENSGGOP00000011482 ENSGGOP00000011482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]