SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011491 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011491
Domain Number 1 Region: 587-665,880-1099
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.12e-63
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 2 Region: 105-267,305-354
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.24e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011491   Gene: ENSGGOG00000011773   Transcript: ENSGGOT00000011824
Sequence length 1117
Comment pep:known_by_projection chromosome:gorGor3.1:2a:90008774:90087423:-1 gene:ENSGGOG00000011773 transcript:ENSGGOT00000011824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAISPGLLVRALLLLQLLLGLAARTVAAGRAHGLPAPTAEAAFGLGAAAAPTSATRVP
AAGTVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVNNE
NAIITLPTIKWKPLIQSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYKKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNSRELAREKVMREVKALAKLEHPGIVRYFNAWL
EAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRS
RSFSVGISCDQTSSSERQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGN
DEGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASTKEEPKTNRLHIGNHCANKLTA
FKPTSSKSSSEATLSISPLRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDW
MNGRCTIEERERSMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLV
TAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLY
PFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFED
LDFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
Download sequence
Identical sequences ENSGGOP00000011491 ENSGGOP00000011491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]