SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011507
Domain Number 1 Region: 518-703
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-31
Family Fibronectin type III 0.00000692
Further Details:      
 
Domain Number 2 Region: 179-281
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-24
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 387-492
Classification Level Classification E-value
Superfamily Fibronectin type III 7.61e-24
Family Fibronectin type III 0.000000846
Further Details:      
 
Domain Number 4 Region: 93-189
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-23
Family I set domains 0.0052
Further Details:      
 
Domain Number 5 Region: 289-379
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-23
Family I set domains 0.0073
Further Details:      
 
Domain Number 6 Region: 7-101
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-22
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011507   Gene: ENSGGOG00000011779   Transcript: ENSGGOT00000011840
Sequence length 1250
Comment pep:known_by_projection chromosome:gorGor3.1:3:79467417:79640335:1 gene:ENSGGOG00000011779 transcript:ENSGGOT00000011840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKL
MISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQV
QGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGKMEASATL
TVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRC
SVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQT
LAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTC
VATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTLSWQPGTPG
TLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSP
MSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGY
RVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKT
VRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCLGNETRFHI
NKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVVITENNNSI
TEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNG
SRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATML
SDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKT
DLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELE
HYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQ
STATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGAL
ISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVAGKAFTSSQRPRPTSP
FSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGG
HSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
Download sequence
Identical sequences G3R807
ENSGGOP00000011507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]