SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011537
Domain Number 1 Region: 23-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000473
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 
Domain Number 2 Region: 282-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000629
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 3 Region: 152-251
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000018
Family I set domains 0.089
Further Details:      
 
Domain Number 4 Region: 416-518
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000461
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011537
Domain Number - Region: 695-804
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000255
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number - Region: 555-587,626-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0046
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011537   Gene: ENSGGOG00000011825   Transcript: ENSGGOT00000011871
Sequence length 878
Comment pep:known_by_projection chromosome:gorGor3.1:1:120038837:120090839:1 gene:ENSGGOG00000011825 transcript:ENSGGOT00000011871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEPENRKLILAFIIAALCRGRVVRVPTGTLVRVVGTELVIPCNVSDYDGPSEQNFDWSFS
SLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCST
PSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTHL
ALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSAD
QGSYRCIVSEWIAEQGNWQEIQEKAVEIATVVIQPTVLRAAVPKNVSVAEGKELDLTCNI
TTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLVR
DVSKENSGYYFCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFA
DDPTELACRVVDTKTGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQ
RAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVNI
FWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLITAEKPVGDLSSPNE
TKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAWS
PVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAALD
PDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQVH
GSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLST
VIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD
Download sequence
Identical sequences ENSGGOP00000011537 ENSGGOP00000011537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]