SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011626 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011626
Domain Number - Region: 550-585
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00863
Family RILP dimerisation region 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011626   Gene: ENSGGOG00000011910   Transcript: ENSGGOT00000011963
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:X:104256524:104296695:-1 gene:ENSGGOG00000011910 transcript:ENSGGOT00000011963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKNGKSELDFDTDQYDILVSDFDTEEKMTGGVTSELPETEYSLRAFCGILYMKPRMKIFL
RQKKVTTQMIAKSLANVEYDTYKPTFTNKQVRITFGFSCKNSNQFGIMMYHNNRLIKSFE
KVGCQVKPTRGEGVGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALAQKLNAYWKEKTS
QDNFETSTVARPIPKVPDQTWVQCDECLKWRKLPGKIDPSMLPARWFCYYNSHPKYRRCS
VPEEQELIDEDLCLSKAKKQEQTVEEKKKMPMENENHQVFSNPPKILTVQEMAGLNNKTI
GYEGIHSPSVLPSGGEESRSPSLQLKPLDSSVVQFSSKYKWILGEEPVEKRRRLQNEMTT
PSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSIL
YPGAKDQRQGSLLPEELEDQMPRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSG
APIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKGRGYEESEGHNTPKMKN
QRELEELKRTTEKLERVLAERNLFQQKVEELEQERNHWQSEFKKVQHELVIYSTQEAEGL
YWSKKHMGYRQAEFQILKAELERTKEEKQELKEKLKETETHLEMLQKAQVSYRTPEGDDL
ERALAKLTRLRIHVSYLLTSVLPHLELREIGYDSEQVDGILYTVLEANHILD
Download sequence
Identical sequences ENSGGOP00000011626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]