SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011758
Domain Number 1 Region: 395-546
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-27
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000205
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000309
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 156-268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000753
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011758   Gene: ENSGGOG00000012048   Transcript: ENSGGOT00000012099
Sequence length 687
Comment pep:known_by_projection chromosome:gorGor3.1:3:192170472:192265639:1 gene:ENSGGOG00000012048 transcript:ENSGGOT00000012099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLWCLVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQKITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSISM
LEFKLGVMCQNSIATKLIVVEYRPLEHPHPGILQLKESVSFVSWKGEKSKHSGSKFWKAL
RLALPLRSLSASSGWNESCSSQSDISLDHVQRRRSRLKEPPELQSSERAAGSPPAPGTMS
KHRGKSSATCRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRL
EPPAPQISALALHHFTDLSNNNDFYIL
Download sequence
Identical sequences G3R8P3
ENSGGOP00000011758 ENSGGOP00000011758 XP_018880267.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]