SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011812 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011812
Domain Number 1 Region: 841-925
Classification Level Classification E-value
Superfamily DEATH domain 6.28e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000419
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000175
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011812   Gene: ENSGGOG00000012106   Transcript: ENSGGOT00000012153
Sequence length 931
Comment pep:known_by_projection chromosome:gorGor3.1:4:104249827:104650822:-1 gene:ENSGGOG00000012106 transcript:ENSGGOT00000012153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLRATAARCGLGLGYLLQMLVLPALATSPRISLGSCFSDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
FTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences ENSGGOP00000011812 ENSGGOP00000011812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]