SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011861 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011861
Domain Number 1 Region: 121-282
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.47e-41
Family Pentapeptide repeats 0.00022
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily POZ domain 1.04e-20
Family Tetramerization domain of potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011861   Gene: ENSGGOG00000012160   Transcript: ENSGGOT00000012202
Sequence length 293
Comment pep:novel chromosome:gorGor3.1:8:31275810:31279245:-1 gene:ENSGGOG00000012160 transcript:ENSGGOT00000012202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYFTTTRSTSVNKEPDTMLVHMFKDKGVWGNKQDHRGAFLIDRSPVYFEPILNYLRHGQ
LIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISQKEFVRFLLATPTKS
ELRCQDLNFSGADLSRLDLRYINFKMANLSRCNLAQANLCCANLERADLSGSVLNCANLQ
GVKMLCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKIAKLK
NCNLRGATLAGTDLENCDLSGCDLQEANLRGSNVKGAVFEEMLTPLHMSQSVR
Download sequence
Identical sequences ENSGGOP00000011861 ENSGGOP00000011861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]