SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011879 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011879
Domain Number 1 Region: 115-286
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-53
Family NadC C-terminal domain-like 0.000024
Further Details:      
 
Domain Number 2 Region: 9-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 5.49e-25
Family NadC N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011879   Gene: ENSGGOG00000012175   Transcript: ENSGGOT00000012220
Sequence length 298
Comment pep:novel chromosome:gorGor3.1:16:30432787:30452139:1 gene:ENSGGOG00000012175 transcript:ENSGGOT00000012220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEGLALLLPPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPF
FDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHRLLLGERVALNTLARCSGIASAAA
AAVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAG
GVEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQ
FPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEAAPVPKIH
Download sequence
Identical sequences ENSGGOP00000011879 ENSGGOP00000011879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]