SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011917 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011917
Domain Number 1 Region: 28-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-22
Family V set domains (antibody variable domain-like) 0.000000837
Further Details:      
 
Domain Number 2 Region: 147-232
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family I set domains 0.063
Further Details:      
 
Domain Number 3 Region: 261-334
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000665
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011917   Gene: ENSGGOG00000012214   Transcript: ENSGGOT00000012258
Sequence length 467
Comment pep:known_by_projection chromosome:gorGor3.1:19:48479209:48490390:1 gene:ENSGGOG00000012214 transcript:ENSGGOT00000012258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAALAPPTPWGRERVEGQKSKRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDP
VHGYWFRAENDISWKAPVATNDPARAVREETRDRFHLLGDPQTKNCTLSIRDARMSDAGR
YFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPSTLESGCFQNLTCSVPWACEQGTPP
MISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPP
QNLTVTIFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQP
SNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQHEYTGKMRPVSGVLLGAVGGAG
ATALVFLSFCVIFIVVRSCRKKSARPAADVGDTGMEDANTIRGSASQGTLTESWADDNPR
HYGLAAPSSGEEREVQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK
Download sequence
Identical sequences ENSGGOP00000011917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]