SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011980
Domain Number 1 Region: 122-219
Classification Level Classification E-value
Superfamily Immunoglobulin 7.04e-26
Family I set domains 0.00066
Further Details:      
 
Domain Number 2 Region: 28-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-24
Family I set domains 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011980   Gene: ENSGGOG00000013781   Transcript: ENSGGOT00000012324
Sequence length 449
Comment pep:known_by_projection chromosome:gorGor3.1:19:52051980:52167998:1 gene:ENSGGOG00000013781 transcript:ENSGGOT00000012324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTVLICLGLSLGPRTHVQAENLLKPILWAEPGPVITWNNPVTIWCQGTLEAQGYRL
DKEGNSMSRHILKTLESENKVKFSIPSMMWEHAGRYHCYYQSPAGWSDPSDPLELVVTGA
CSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHVAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPRPSPTRSVSTAAGPED
QPLRPTGSGPHSGLRRHWEVLIGVLVVSVLLLSLLLFLLLQHWHQGEHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAAEVQGENLSDAAVKNTQPEDGVEMDTRQSPHNEDPQAVT
YAPVKHSRPRREMASPPSSLSEEFLDTKDTQAEEDRQMDTQAAASEASQDVTYAQLHSLT
LRRKATEPPPSQEGPSPAEPSIYATLAIH
Download sequence
Identical sequences ENSGGOP00000011980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]