SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011991 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011991
Domain Number 1 Region: 843-1044
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-38
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 640-831
Classification Level Classification E-value
Superfamily Fibronectin type III 3.56e-33
Family Fibronectin type III 0.00000228
Further Details:      
 
Domain Number 3 Region: 352-449
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 543-632
Classification Level Classification E-value
Superfamily Immunoglobulin 9.56e-19
Family I set domains 0.0098
Further Details:      
 
Domain Number 5 Region: 272-362
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 447-546
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 39-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 144-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000456
Family I set domains 0.032
Further Details:      
 
Domain Number 9 Region: 1064-1139
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000534
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011991   Gene: ENSGGOG00000012271   Transcript: ENSGGOT00000012335
Sequence length 1220
Comment pep:known_by_projection chromosome:gorGor3.1:7:105842051:106090852:-1 gene:ENSGGOG00000012271 transcript:ENSGGOT00000012335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIV
IQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTA
RNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSF
QRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVDELN
DTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPIIYWA
KEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAAPYWIT
APQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFSNVQER
SSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPT
VEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDP
TWIVKQPEYAVVQRGSMVSFECKVKHDHTLTLTVLWLKDNRELPSDERFTVDKDHLVVAD
VSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQL
SWTPGDDNNSPITKFIIEYEDAMHEPGLWHHQTEVSGTQTTAQLKLSPYVNYSFRVMAVN
SIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGLQYKVS
WRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHSGEDLP
MVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILT
FQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTL
DSLTLEWDPPSHPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYK
FYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQALNPRISNLTAAAAETYANIS
WEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAVGDSGFV
SSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPVKEKED
AHADPEIQPMKEDDGTFGEY
Download sequence
Identical sequences ENSGGOP00000011991 ENSGGOP00000011991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]