SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012034 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012034
Domain Number 1 Region: 311-369
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000131
Family BSTI 0.035
Further Details:      
 
Domain Number 2 Region: 676-738
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000576
Family BSTI 0.076
Further Details:      
 
Domain Number 3 Region: 778-839
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000131
Family ATI-like 0.016
Further Details:      
 
Domain Number 4 Region: 1149-1204
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000772
Family BSTI 0.056
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012034
Domain Number - Region: 369-410
Classification Level Classification E-value
Superfamily FnI-like domain 0.000534
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 839-878
Classification Level Classification E-value
Superfamily FnI-like domain 0.00387
Family VWC domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012034   Gene: ENSGGOG00000012304   Transcript: ENSGGOT00000012379
Sequence length 3882
Comment pep:known_by_projection chromosome:gorGor3.1:11:1161636:1199329:1 gene:ENSGGOG00000012304 transcript:ENSGGOT00000012379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVPQAETQGPVEPSWGNAGHTTDGGAPTSSPTRRVSFVPPVTVFPSLSPLNPAHNGRV
CSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRRGLVGSRPVVTRVVIKA
QGLVLEASNGSVLVNGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELD
PKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLPLPAGNCT
DEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCPTCPCATFVEYSRQCAHAGGQP
RNWRRPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITH
SGCLPLGQCPCTHGGRTYSPGTSFNNTCSSCTCSGGLWQCQDLPCPGTCSVQGGAHISTY
DEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTENENCLKAVTLSLDGGDTAIRVQA
DGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQG
QMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARNSFEDPCSLSVENEN
YARHWCSRLTDPNSAFSRCHSVINPKPFHSNCMFDTCNCERSEDCLCAALSSYVHACATK
GVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPA
GTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEDAVCSCAGGKLSCLGASLQKSTGCAA
PMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDCP
CVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGDGHFITFDGDRYSFEGS
CEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVAR
GPGGDPPYKIRYMGIFLVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAIND
FATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAAC
RSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCD
FYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVA
QCGCYDKDGNYYDVSARVPTAENCQSCNCTPSGIQCAHSLEACTCTYEDRTYSYQDVIYN
TTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVRE
VCHWSSWYNGHRPEPSLGGGDFETFENLRQRGYQVCPVPADIECRAGQLPDMPLEELGQQ
VDCDRMRGLMCANSQQSPPLCHDYELRVLCCEYVPCGPSPAPGTSPQPSLSASTEPAVPT
PTQTTATEKTTLWVTPSVRSTAALTSQTGSSSGPMTVTPSAPGTTTCQPRCQWTEWFDED
YPKSEQLGGDVESYDKIRATGGHLCQQPKDIECQAESFPNWTLAQVGQKVHCDVRFGLVC
RNWEQEGVFKMCYNYRIRVLCCRDDHCRGRATTPPPTTELETATTTTTQALFSTLQPTSS
PGVTRAPPASTTAVPTLSEGLTSPRYTSTLGTATTGGPTTPAGPTEPTVPEVATSSLPTR
SALPGTTGSLGTWRPSQPPTLAPTTMATSRAHPTGTAGTASKGPGTTSLAPTLTSKLSTS
QAKTSTPRTETTMSPLTNATTSQGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRA
AGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRV
LCCDDYSHCPSTPATSSTATPSSTPGTTWILTEPTTTAITTVAMGSTATPTSTPGTAPPP
KVLTTTATTPTVTSSKATPSSSPGTATTLPAPISTATTPTATSFTAIPSSSLGTTWTRLS
QATTPTATMSTATPSSTPETAHTSTVLTATATTTGATGSVATPSSTPGTAHTTKVLTTTT
TGFTATPSSSPGTARTLPVWISTTTTPTNRGSTVTPSSTPGTTHTPTVLTTTTTTVATGS
MATPSSSTQTPGTPPPLTTTATMITATGSTTNPSSTPGTTPIPPVSTTMATTQGQSLPPS
SPQTLPTAWTLATSGTLGTTHITEPSMVTSHTPAATTGTTQHSTPALSSPHPSSRTIKSP
PSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCVWSEWLD
YSYPMPGPSGGDFDTYSNIRAAGGAICEQPLGLECRAQAQPGVPLQELGQVVECSLDFGL
VCRNREQVGKFKMCFNYEIRVFCCNYVRCPSTPATSSMTTPSSTPGTTWILTELTTAATT
TASTGSTATPSSTPGTTWILTEPTTTATVMVPTGSMATASSTQATAGTPNVTTMATTPTV
TSSKATPSSSPGTATTLPALISTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTA
TPSSTPETAHTSKVLTAMATTTGATGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPG
TARTPPVWISTTTTPTTRGSTVTPSSIPGTTHSATVLTTTTTVATGSMATPSSSTQTPVL
TSTATKSTATSFTPIPSSTLWTTWTIPAQTTTPMSTRSTIHTSSTPETTHTSTVLTTTAT
TTRATNSTATPSSTPGTTWILTELTTAATTTAASGPTATPSSTPGTTWILTEPTATATVT
VPTGSTATASSTLGTAHTPKVLTTTATTPTVTRFPARPPWGPPAPPQCSPAACQPSCLGD
RWHPFRKPSCGSHSGDAGCHDAWGARAPPRSLPARPSLSRRHLQHARLPYSLFHNNTEGQ
CGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPPAPVSSTP
TPTPCPPQPLCTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTTTMSTATPSSTPETAHT
SKVLTVMATTTGATGSAATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTARTLPVWIST
TTTHTNSGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTPGTSTIHTSSTPE
TTHTSTVPTTTATMTRATNSTATPSSTPGTTWILTELTTTATTTASTGSMATPSSTPGTT
WILTEPTTTATVTVPTGSMATASSTRATAGTPNVTTTATTPTVTSSKTTPSSSPGTATTL
PALISTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTA
TATTTGATGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTAPTLPVWISTTTTPTT
SGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTPARDNTHPPSVNHHSHHTG
AVPAPQQSPDGAHSLDFGHLGPSADHHCHHTCCHQQHSDSLLCPRDHPHTPSAGKTTVGL
TTATSRTTATPSKTSTSTLLPSSPTPAPTTPVVTTGCEPQCAWSDWLDYSYPMPGPSGGD
FDTYSNIRAAGRAVCEQPLGLECRAQAQPGVPCGSWARQSVPTGHTRSPLATIHPHWPHS
VPTGHNPSSLAILGPHWPHSASALSTPFPGTAAPSCSDLCLCSPRTLAYPSLGMAFLSMV
LFFTGEVIYNKTDRAGCHFYAVCNQHCDIDRFQGACPTSPPPVSSAPLSSPSPAPGCDNA
IPLRQVNETWTLENCTVARCVGDNRVILLDPKPVANVTCVNKHLPIKVLDPSQPCDFHYE
CECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCAASAAAARC
PRALSIHYKSMDIVLTVTMVHGKEECLILFDQIPVSSGFSKN
Download sequence
Identical sequences ENSGGOP00000012034 ENSGGOP00000012034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]