SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012161 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012161
Domain Number 1 Region: 295-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-62
Family SPRY domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 28-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-23
Family V set domains (antibody variable domain-like) 0.0000783
Further Details:      
 
Domain Number 3 Region: 151-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000143
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012161   Gene: ENSGGOG00000012465   Transcript: ENSGGOT00000012513
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:6:27368009:27376286:1 gene:ENSGGOG00000012465 transcript:ENSGGOT00000012513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEH
LELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDG
EYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEIRLECTSVGWYPEPQVQWRTS
KGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKEVEISIPASSL
PRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATL
HAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKPERFDSWPCVLGRETFTSGRHYW
EVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTVIANAQDLSKEIPLCPIGEDSAPRDADTL
HSKLIPTQPSQGAP
Download sequence
Identical sequences ENSGGOP00000012161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]