SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012212 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012212
Domain Number 1 Region: 47-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000178
Family V set domains (antibody variable domain-like) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012212   Gene: ENSGGOG00000012519   Transcript: ENSGGOT00000012565
Sequence length 230
Comment pep:known_by_projection chromosome:gorGor3.1:5:19806319:19809934:1 gene:ENSGGOG00000012519 transcript:ENSGGOT00000012565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLALSPVPSHWMVALLLLLSAAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGF
TVKMHCYVNSASGNVSWLWKQEMDENPQLLKLEKGRMEESQNESLATLTIQGIRFEDNGI
YFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFL
LLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Download sequence
Identical sequences G3R9W5
XP_018884167.1.27298 ENSGGOP00000012212 ENSGGOP00000012212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]