SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012279 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012279
Domain Number 1 Region: 35-141
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-24
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012279   Gene: ENSGGOG00000012591   Transcript: ENSGGOT00000012634
Sequence length 252
Comment pep:known_by_projection chromosome:gorGor3.1:19:39110449:39126709:1 gene:ENSGGOG00000012591 transcript:ENSGGOT00000012634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTSAQLTIESTPFNVAEGKEVLLLAHSLPQ
NRIGYTWYKGERVDGNSLIVGYAVGIQQATPGPAYSGRETINPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTG
RTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNI
YCRMDHKAEVAS
Download sequence
Identical sequences G3RA24
ENSGGOP00000012279 XP_004060852.1.27298 ENSGGOP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]