SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012318 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012318
Domain Number 1 Region: 250-316
Classification Level Classification E-value
Superfamily FnI-like domain 5.65e-16
Family VWC domain 0.0044
Further Details:      
 
Domain Number 2 Region: 109-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000984
Family VWC domain 0.023
Further Details:      
 
Domain Number 3 Region: 32-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000111
Family VWC domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012318   Gene: ENSGGOG00000012629   Transcript: ENSGGOT00000012675
Sequence length 452
Comment pep:known_by_projection chromosome:gorGor3.1:11:71704519:71745295:-1 gene:ENSGGOG00000012629 transcript:ENSGGOT00000012675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSESAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPTKSCQHNGTMYQH
GEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASE
QSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPC
RHPEKVAGKCCKICPEDKADSGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA
SDLVEIYLWKLVKDEETEAQRGEVPGPRPHSQNLPLDSDQESQEARLPERGTALPTARWP
PRRSLERLPSPDPGAEGHGQSRQSDQDIITKT
Download sequence
Identical sequences ENSGGOP00000025361 ENSGGOP00000012318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]