SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012425 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012425
Domain Number 1 Region: 143-290
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-29
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 9-130
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000105
Family Cell cycle control phosphatase, catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012425   Gene: ENSGGOG00000012743   Transcript: ENSGGOT00000012785
Sequence length 574
Comment pep:novel chromosome:gorGor3.1:10:58944809:58946587:-1 gene:ENSGGOG00000012743 transcript:ENSGGOT00000012785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKKLASLLRGGPGGLVIDSHSFLEYNSWHVLSSVKICCSKLVKWRLQK
GKVTIAEFIQPAARSQVEATEPQDVVVYDQSTAADSFLSILLSKLDGCFHSVAGFATFSS
CFPDLCEGEPAALLPMSLSQSCLLVPSVGLTLILPHLYLGSQEDVLNKDLMTQNGISYVL
YASNSCPKPDFIYQSHFLRVPINDNYCEKLLPWLDKSIEFVDKAKLSSCQVIVHRLAGIS
CCATIAIAYIMKTMGMSSEDAYRFVKDQRPSISPNFNFLGQLLEYQSSLKLLAAVQGDAG
TPSGMPEPPPSPAAGAPVPWLPPPTSETAATRSAAAREGGPSAGREPPAPPTATSTLQQG
LRSLHLSSDHLPDTSRLKPSFSLDIKSAYAPSRRPDGGPSDPGEAPKLKLDSQSGTLGLP
SPCPDAAPARPRPGRYPARGLNFGYAPGPGQPASPGAWTPPLDSPGTPSPDVPWCFSPEG
VQGAGGVLFAPFGRAGALENNGCSDLPRREAARAEPDARTSWSDELAPDSQFKCCSCQME
FEEGMVEGRARGEELAALGKQGSFLGSVEVIEMS
Download sequence
Identical sequences ENSGGOP00000012425 ENSGGOP00000012425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]