SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012441 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012441
Domain Number 1 Region: 31-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000984
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 
Domain Number 2 Region: 154-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000107
Family C1 set domains (antibody constant domain-like) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012441   Gene: ENSGGOG00000012756   Transcript: ENSGGOT00000012801
Sequence length 332
Comment pep:known_by_projection chromosome:gorGor3.1:6:27304944:27312801:1 gene:ENSGGOG00000012756 transcript:ENSGGOT00000012801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPRHLFPTMSA
ETTELRWVSSSLRQVVNLYADGKEVEDRQSAPYRGRTSILRDGITAGKAALIHNVTASDS
GKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGRIHLECGSTGWHPQPQIQWSE
AKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLSLEKTASISIADPF
FRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATEQE
ISLREKLQEELKWRKIQYMARGEKSLAYHGEA
Download sequence
Identical sequences ENSGGOP00000012441 ENSGGOP00000012441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]