SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012444
Domain Number 1 Region: 936-1022
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-19
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 239-340
Classification Level Classification E-value
Superfamily Immunoglobulin 9.61e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 857-944
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 339-440
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 
Domain Number 5 Region: 642-742
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000808
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 34-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000238
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 544-646
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000584
Family I set domains 0.058
Further Details:      
 
Domain Number 8 Region: 134-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000969
Family C1 set domains (antibody constant domain-like) 0.058
Further Details:      
 
Domain Number 9 Region: 736-838
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000299
Family I set domains 0.017
Further Details:      
 
Domain Number 10 Region: 444-547
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000312
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012444   Gene: ENSGGOG00000012741   Transcript: ENSGGOT00000012805
Sequence length 1241
Comment pep:known_by_projection chromosome:gorGor3.1:19:33126325:33151802:-1 gene:ENSGGOG00000012741 transcript:ENSGGOT00000012805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGTTLRASLLLLGLLTEGLAQLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGS
AVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSETGP
ELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVSCVSGDAKPAPDITILLSGQTI
SDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPP
GPPVIEWPGLDEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTAWGTEHTQAVARS
VLVMTVRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQTENKNVTLS
CVSKSSRPRVLLRWWLGWRQLLPMEETVMDGLHGGHISMSNLTFLARREDNGLTLTCEAF
SEAFTKETFKKSLILNVKYPAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYK
DSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLA
VQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAAPPRRAPFK
GSAAARSVLLQVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEFLGEQVLVVTAVE
QGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLH
CQNSEGTAEALLRLDVHYAPTIRALQDPTEVNVGGSVDIVCTVDANPILPGMFSWERLGE
DEEDQSLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLVRLVVRFAPQV
EHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGIPLDLQDPRYTEHIYHQGGVH
SSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLE
WKPGFDGGLPQRFCIRYEALGTPGFHYVDVLPPQATTFTLTGLQPSTRYRVWLLASNALG
DSGLADKGTQLPITTPGGKGGLGRLEFTEGYLPPLGPSGLPLLPVLFALGGLLLLSNASC
VGGVLWQRRLRRLAEGISEKTEAGSEEDRVRNEYEESQWTGERDTRSSTVSTTEAEPYYR
SLRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGP
RDLRWPEDTYQDPRGIYDQVAGDLDTLEPDSLPFELRGHLV
Download sequence
Identical sequences ENSGGOP00000012444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]