SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012474 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012474
Domain Number 1 Region: 60-253
Classification Level Classification E-value
Superfamily L domain-like 2.27e-31
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 433-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000136
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012474   Gene: ENSGGOG00000012795   Transcript: ENSGGOT00000012835
Sequence length 625
Comment pep:known_by_projection chromosome:gorGor3.1:10:97278083:97288201:-1 gene:ENSGGOG00000012795 transcript:ENSGGOT00000012835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMRVALGMLWLLALAWSPQARGFCPSQCSCSLHIMGDGSKASRTVVCNDPDMTLPPASIP
PDTSRLRLERTAIRRVPGEAFRPLRRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNR
LAAFPWAALRDAPQLRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLTRLPQELIVSW
AHLKTGIFPPGHHPRLVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSL
AGVAFSQLELRKCQGPELHPGVASIRSLLGGTALLRCGATGVPGPEMSWRRANGRPLNGT
VHQEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEHTGSP
GALWARTGGGGEAAAYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGEL
SDGRAGPSEARMVRSVKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQP
GKTRVTITGLLPKTKYVACVCVQGLVPRKEQCVIFSTNEVVDAENTQQLINVVVISVAIV
IALPLTLLVCCGALQKRCRKCFNRDSTEATVTYINLERLGHSEDGLEELSRHSVSEADRL
LSARSSVDFQAFGVKRGRRINEYFC
Download sequence
Identical sequences ENSGGOP00000012474 ENSGGOP00000012474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]