SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012480 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012480
Domain Number 1 Region: 736-1315
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.59e-203
Family Myeloperoxidase-like 0.000000000513
Further Details:      
 
Domain Number 2 Region: 69-250
Classification Level Classification E-value
Superfamily L domain-like 2.27e-41
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 343-437
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-26
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 427-522
Classification Level Classification E-value
Superfamily Immunoglobulin 9.17e-25
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 528-616
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-24
Family I set domains 0.043
Further Details:      
 
Domain Number 6 Region: 246-340
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 1415-1473
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000188
Family VWC domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012480   Gene: ENSGGOG00000012776   Transcript: ENSGGOT00000012841
Sequence length 1480
Comment pep:known_by_projection chromosome:gorGor3.1:2a:1633180:1752807:-1 gene:ENSGGOG00000012776 transcript:ENSGGOT00000012841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRXXXXXXXXXXVI
IPFLFLHRDLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYK
NEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFN
HLESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAATCEYPRRIQGRSVATITPE
ELNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDD
GTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESV
TLECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQEDSGEYACSATNNID
SVHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRH
LVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVG
ANVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECAARNT
IGSASVSMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLA
LFRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIAN
LSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPR
GINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQA
RFSDGQHCSSVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYP
REQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTEC
MRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETR
KIVGAEIQHITYQHWLPKILGEVGMRTLGEYRGYDPGINAGIFNAFATAAFRFGHTLVNP
LLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTEL
TERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIRE
KLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSP
AQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDC
RTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPQKIPSVGRQGEHLSNSTSAFSTRSDA
SGTNDFREFVLEMQKTITDLRTQIQKLESRLSTTECVDAGGESHANNTKWKKDACTICEC
RDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Download sequence
Identical sequences ENSGGOP00000012480 ENSGGOP00000012480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]