SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012565
Domain Number 1 Region: 365-522
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-30
Family Toll/Interleukin receptor TIR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000328
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 25-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000227
Family I set domains 0.054
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012565
Domain Number - Region: 128-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000612
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012565   Gene: ENSGGOG00000012879   Transcript: ENSGGOT00000012927
Sequence length 541
Comment pep:known_by_projection chromosome:gorGor3.1:2a:99868873:99905085:1 gene:ENSGGOG00000012879 transcript:ENSGGOT00000012927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCRELPLTLWVLIFVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMENYTQKWKLNVIRRNKQSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEIRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDESEVLPVLSE
S
Download sequence
Identical sequences G3RAT7
XP_018877150.1.27298 ENSGGOP00000012565 ENSGGOP00000012565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]