SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012616 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012616
Domain Number 1 Region: 474-676
Classification Level Classification E-value
Superfamily Fibronectin type III 4.53e-42
Family Fibronectin type III 0.0000522
Further Details:      
 
Domain Number 2 Region: 1083-1279
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-39
Family Fibronectin type III 0.0000141
Further Details:      
 
Domain Number 3 Region: 676-865
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-35
Family Fibronectin type III 0.0000375
Further Details:      
 
Domain Number 4 Region: 875-1083
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-34
Family Fibronectin type III 0.0000181
Further Details:      
 
Domain Number 5 Region: 1608-1805
Classification Level Classification E-value
Superfamily Fibronectin type III 5.55e-33
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 1461-1609
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-31
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 7 Region: 1283-1428
Classification Level Classification E-value
Superfamily Fibronectin type III 4.56e-29
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 285-377
Classification Level Classification E-value
Superfamily Immunoglobulin 5.08e-21
Family I set domains 0.0088
Further Details:      
 
Domain Number 9 Region: 183-283
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 10 Region: 383-479
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 11 Region: 98-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000631
Family I set domains 0.024
Further Details:      
 
Domain Number 12 Region: 7-74
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000242
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012616   Gene: ENSGGOG00000012912   Transcript: ENSGGOT00000012980
Sequence length 2022
Comment pep:known_by_projection chromosome:gorGor3.1:7:3274737:4260018:1 gene:ENSGGOG00000012912 transcript:ENSGGOT00000012980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDQRKTVSQGRAAILNLLPITSYPRPQVTWFREGHKIIPSNRIAITLENQLVILATTT
GDTGAYYVQAVNEKNGENKTSPFIHLSIARDVGTPETMAPTIVVPPGNRSVVAGSSETTL
ECIASARPVEDLSVTWKRNGVRITSGLHSFGRRLTISNPTSADTGPYVCEAALRGSTFEP
ARATAFLFIIEPPYFTAEPESRISAEVEETVDIGCQAMGVPLPTLQWYKDAISISRLQNP
RYKVLTSGGLRIQKLRPEDSGIFQCFASNEGGEIQTHTYLDVTNIAPVFTQRPVDTTVTD
GMTAILRCEVSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQIAPVFIQDAGNYTC
YAANTEGSLNASATLTVWNRTSIVHPPEDHVVIKGTTATLHCGATHDPRVSLRYVWKKDN
VALTPSSTSRIVVEKDGSLLISQTWSGDIGDYSCEIVSEGGNDSRMARLEVIELPHSPQN
LLASPNSSHSHAVVLSWVRPFDGNSPILYYIVELSENNSPWKVHLSNVGPEMTGVTVSGL
TPARTYQFRVCAVNEVGRGQYSAETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPP
ETEHNGVLRGYILRYRLAGLPGEYQQRNITSPEVNYCLVTDLIIWTQYEIQVAAYNGAGL
GVFSRAVTEYTLQGVPTAPPQNVQTEAVNSTTIQFLWNPPPQQFINGINQGYKLLAWPAD
APEAVTVVTIAPDFHGVHHGHITNLKKFTAYFTSVLCFTTPGDGPPSTPQLVWTQEDKPG
AVGHLSFTEILDTSLKVSWQEPLEKNGIITGYQISWEVYGRNDSRLTHTLNSTTHEYKIQ
GLSSLTTYTIDVAAVTAVGAGLVTSSTISSGVPPDLPGAPSNLVISNISPRSATLQFRPG
YDGKTSISRWIVEGQVGAIGDEEEWVTLYEEENEPDAQTLEIPNLTPYTHYRFRMKQVNI
VGPSPYSQSSRVIQTLQAPPDVAPTSVTVRTASETSLRLRWVPLPDSQYNGNPESVGYRI
KYWRSDLQSSAVAQVVSDRLEREFTIEELEEWMEYELQMQAFNAVGAGPWSEVVRGRTRE
SVPSAAPENVSAEAVSSTQILLTWASVPEQDQNGLILGYKILFRAKDLDPEPRSHIVRGN
HTQSALLAGLRKFVLYELQVLAFTRIGNGVPSTPLILERTKDDAPGPPVRLVFPEVRLTS
VRIVWQPPEEPNGIILGYQIAYRLASSSPHTFTTVEVGATVRQFTATNLAPESAYIFRLS
AKTRQGWGEPLEATVITTEKRERPAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRYFT
VQVRELPRGEWQTYSSSISHEATACVVDRLRPFTSYKLRLKATNDIGDSDFSSETEAVTT
LQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELEYEAGSGTEAKT
LKSPIALRAELTAQSTFKTVNSSSTSTMCELTHLKKYRRYEVIMTAYNIIGESPASAPVE
VFVGEAAPAMAPQNVQVTPLTASQLEITWDPPPPESQNGNIQGYKIYYWEADSQNETEKM
KVLFLPEPVVRLKNLTSHTKYLVSISAFNAAGDGPRSDPQQGRTHQAAPGAPSFLAFSEI
TSTTLNVSWGEPAAANGILQGYRVVYEPLAPVQAAGVSKVVTVEVRGNWQRWLKVRDLTK
GVTYFFHVQARTITYGPELQANITAGPAEGSPGSPRDVLVTKSASELTLQWTEGHSGDTP
TTGYVIEARPSDEGLWDMFVKDIPRSATSYTLSLDKLRQGVTYEFRVVAVNEAGYGEPSN
PSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFALVLHGQNKKYKNCSTGKGISTME
ESVTLDNGGFAALELSSRHLNVKSTFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLT
ESVSLKEKSADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYE
AVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTPLTGFSSFV
Download sequence
Identical sequences ENSGGOP00000012616 ENSGGOP00000012616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]