SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012649
Domain Number 1 Region: 324-474,516-677
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.21e-48
Family WD40-repeat 0.0084
Further Details:      
 
Domain Number 2 Region: 215-338
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000157
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 645-792
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000683
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012649   Gene: ENSGGOG00000012958   Transcript: ENSGGOT00000013014
Sequence length 793
Comment pep:known_by_projection chromosome:gorGor3.1:14:81699146:81865301:1 gene:ENSGGOG00000012958 transcript:ENSGGOT00000013014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTK
ARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGG
RRESNGDSRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKD
QVDSYSLEAKVELPTKRLKLEWISYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQ
LQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIG
FFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPT
DTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNIL
VWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQ
FGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCG
HDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVH
TDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSV
NSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDI
NAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLIST
GGKDTSIMQWRII
Download sequence
Identical sequences ENSGGOP00000012649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]