SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012670 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012670
Domain Number 1 Region: 295-592
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-73
Family Kelch motif 0.0000267
Further Details:      
 
Domain Number 2 Region: 22-141
Classification Level Classification E-value
Superfamily POZ domain 8.37e-33
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012670   Gene: ENSGGOG00000012990   Transcript: ENSGGOT00000013035
Sequence length 616
Comment pep:known_by_projection chromosome:gorGor3.1:16:75191796:75207178:1 gene:ENSGGOG00000012990 transcript:ENSGGOT00000013035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEGSRQTRVSRPYKISESSKVYRWADHSGTVLQRLNEQRLRGLFCDVVLVADEQRVPAH
RNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFLYGGELVLDGGNIDYVL
ETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSF
TPDFLQNVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEREAHARQVLENIHFPLI
PKNDLLHRVKPAVCSLLPKEANCEGFIEEAVRYHNNLAAQPVMQTKRTALRTNQERLLFV
GGEVSERCLELSDDTCYLDAKSEQWVKETPLPARRSHHCVAVLGGFIFIAGGSFSRDNGG
DAASNLLYRYDPRCKQWIKVASMNQRRVDFYLASIEDMLVAVGGRNENGALSSVETYSPK
TDSWSYVAGLPRFTYGHAGTIYKDFVYISGGHDYQIGPYRKNLLCYDHRTDVWEERRPMT
TARGWHSMCSLGDSIYSIGGSDDNIESMERFDVLGVEAYSPQCNQWTRVAPLLHANSESG
VAVWEGRIYILGGYSWENTAFSKTVQVYDREADKWSRGVDLPKAIAGGSACVCALEPRPE
DKKKKGKGKRHQDRGQ
Download sequence
Identical sequences A0A2I2YKJ8
ENSGGOP00000012670 ENSGGOP00000012670 XP_018867961.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]