SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012823 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012823
Domain Number 1 Region: 32-365
Classification Level Classification E-value
Superfamily L domain-like 3.29e-59
Family Ngr ectodomain-like 0.068
Further Details:      
 
Domain Number 2 Region: 409-500
Classification Level Classification E-value
Superfamily Immunoglobulin 8.75e-21
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012823   Gene: ENSGGOG00000013148   Transcript: ENSGGOT00000013193
Sequence length 606
Comment pep:known_by_projection chromosome:gorGor3.1:9:28446175:28533890:-1 gene:ENSGGOG00000013148 transcript:ENSGGOT00000013193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINSMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI
Download sequence
Identical sequences G3RBG8
ENSGGOP00000012823 XP_018889816.1.27298 ENSGGOP00000012823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]